PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002357.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 256aa    MW: 28724.5 Da    PI: 8.1946
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002357.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR128.45.3e-093686152
                     FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkteker 52
                             +fY++Y  +vGF +r +   ks ++g i++++ vC++eg++++  +++++++
  Itr_sc002357.1_g00003.1 36 EFYKNYVVKVGFVTRSNFVVKS-QDGMIVTKHIVCNREGFKNSGAQHSNSKS 86
                             6****************99999.8888**************99988844433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.8E-73685IPR004330FAR1 DNA binding domain
PfamPF105513.7E-9144187IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MLFICYSSND LQSGNNLNEI KPLLGMSFTT LEAATEFYKN YVVKVGFVTR SNFVVKSQDG  60
MIVTKHIVCN REGFKNSGAQ HSNSKSNVDA GEGIPFQRGK EFQTELVAKL GLYSSTREVL  120
VMSCAGYFGQ IQSQKKNYVA FRDVVSFDGT YSTNRYSMVF TPFTGVDNHK KCVTFGVGLL  180
LKEDIKDVFM GGLLRTTSRS ESENYAFSRF TIPQSSLVEF LINFDSALDS QRHINAKHNS  240
DNEWSRYVSP VSLVEC
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3136228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.16e-11FAR1 family protein